SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011186 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011186
Domain Number 1 Region: 1013-1350
Classification Level Classification E-value
Superfamily NHL repeat 2.25e-25
Family NHL repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 1319-1338,1367-1485
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000157
Family SGL-like 0.066
Further Details:      
 
Domain Number 3 Region: 708-783
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000314
Family Pre-dockerin domain 0.073
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000011186
Domain Number - Region: 546-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000266
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 450-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00032
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 516-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00035
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 584-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000579
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 382-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00145
Family Integrin beta EGF-like domains 0.029
Further Details:      
 
Domain Number - Region: 417-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00312
Family Integrin beta EGF-like domains 0.042
Further Details:      
 
Domain Number - Region: 352-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 482-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.099
Family Integrin beta EGF-like domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011186   Gene: ENSSTOG00000012468   Transcript: ENSSTOT00000012481
Sequence length 2547
Comment pep:novel scaffold:spetri2:JH393364.1:6183572:6370426:-1 gene:ENSSTOG00000012468 transcript:ENSSTOT00000012481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEQPANNQGQSTLQPLPPSHKQHSAQHHPSITSLNRNSLTNRRNQSPAPPAALPAELQTT
PESVQLQDSWVLGSNVPLESRHFLFKTGTGTTPLFSTATPGYTMASGSVYSPPTRPLPRN
TLSRSAFKFKKSSKYCSWKCTALCAVGVSVLLAILLSYFIAMHLFGLNWQLQQTENDTFE
NGKVNSDTMPTNTVSLPSGDNGKLGGFTQENNTIDSGELDIGRRAVQEVPPGIFWRSQLF
IDQPQFLKFNISLQKDALIGVYGRKGLPPSHTQYDFVELLDGSRLIAREQRNLVESERAG
RQARSVSLHEAGFIQYLDSGIWHLAFYNDGKNAEQVSFNTIVIESVVECPRNCHGNGECV
SGTCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCLCFSGWKGTECDVPTTQCIDPQCGG
RGICIMGSCACNSGYKGENCEEADCLDPGCSNHGVCIHGECHCNPGWGGNNCEILKTMCP
DQCSGHGTYLQESGSCTCDPNWTGPDCSNEICSVDCGSHGVCMGGTCRCEEGWTGPACNQ
RACHPRCAEHGTCKDGKCECSQGWNGEHCTIAHYLDKIVKAEGCPGLCNSNGRCTLDQNG
WHCVCQPGWRGAGCDVAMETLCTDSKDNEGDGLIDCMDPDCCLQSSCQNQPYCRGLPDPQ
DIISQSLQSPSQQAAKSFYDRISFLIGSDSTHVIPGESPFNKSLASVIRGQVLTADGTPL
IGVNVSFFHYPEYGYTITRQDGMFDLVANGGASLTLVFERSPFLTQYHTVWIPWNVFYVM
DTLVMKKEENDIPSCDLSGFVRPNPIIVSSPLSTFFRSSPEDSPIIPETQVLHEETTIPG
TDLKLSYLSSRAAGYKSVLKITMTQSIIPFNLMKVHLMVAVVGRLFQKWFPASPNLAYTF
IWDKTDAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRTAILQGYELDASNMGGWTLDKH
HVLDVQNGILYKGNGENQFISQQPPVVSSIMGNGRRRSISCPSCNGQADGNKLLAPVALA
CGIDGSLYVGDFNYVRRIFPSGNVTSVLELRNKDFRHSSNPAHRYYLATDPVTGDLYVSD
TNTRRIYRPKSLTGAKDLTKNAEVVAGTGEQCLPFDEARCGDGGKAVEATLMSPKGMAVD
KNGLIYFVDGTMIRKVDQNGIISTLLGSNDLTSARPLTCDTSMHISQVRLEWPTDLAINP
MDNSIYVLDNNVVLQITENRQVRIAAGRPMHCQVPGVEYPVGKHAVQTTLESATAIAVSY
SGVLYITETDEKKINRIRQVTTDGEISLVAGIPSECDCKNDANCDCYQSGDGYAKDAKLN
APSSLAASPDGTLYIADLGNIRIRAVSKNKPLLNSMNFYEVASPTDQELYIFDINGTHQY
TVSLVTGDYLYNFSYSNDNDITAVTDSNGNTLRIRRDPNRMPVRVVSPDNQVIWLTIGTN
GCLKSMTAQGLELVLFTYHGNSGLLATKSDETGWTTFFDYDSEGRLTNVTFPTGVVTNLH
GDMDKAITVDIESSSREEDVSITSNLSSIDSFYTMVQDQLRNSYQIGYDGSLRIIYASGL
DSHYQTEPHVLAGTANPTVAKRNMTLPGENGQNLVEWRFRKEQAQGKVNVFGRKLRVNGR
NLLSVDFDRTTKTEKIYDDHRKFLLRIAYDTSGHPTLWLPSSKLMAVNVTYSSTGQIASI
QRGTTSEKVDYDGQGRIVSRVFADGKTWSYTYLEKSMVLLLHSQRQYIFEYDMWDRLSAI
TMPSVARHTMQTIRSIGYYRNIYNPPESNASIITDYNEEGLLLQTAFLGTSRRVLFKYRR
QTRLSEILYDSTRVSFTYDETAGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRFSEDGM
VNARFDYSYDNSFRVTSMQGVINETPLPIDLYQFDDISGKVEQFGKFGVIYYDINQIIST
AVMTYTKHFDAHGRIKEIQYEIFRSLMYWITIQYDNMGRVTKREIKIGPFANTTKYAYEY
DVDGQLQTVYLNEKIMWRYNYDLNGNLHLLNPSNSARLTPLRYDLRDRITRLGDVQYRLD
EDGFLRQRGTEIFEYSSKGLLTRVYSKGSGWTVIYRYDGLGRRVSSKTSLGQHLQFFYAD
LTYPTRITHVYNHSSSEITSLYYDLQGHLFAMEISSGDEFYIASDNTGTPLAVFSSNGLM
LKQIQYTAYGEIYFDSNIDFQLVIGFHGGLYDPLTKLIHFGERDYDILAGRWTTPDIEIW
KRIGKDPAPFNLYMFRNNNPASKIHDVKDYITDVNSWLVTFGFHLHNAIPGFPVPKFDLT
EPSYELVKSQQWDDVPPIFGVQQQVARQAKAFLSLGKMAEVQVSRRKAGSEQSWLWFATV
KSLIGKGVMLAVSQGRVQTNVLNIANEDCIKVAAVLNNAFYLENLHFTIEGKDTHYFIKT
TTPESDLGTLRLTSGRKALENGINVTVSQSTTVVNGRTRRFADVEMQFGELALHVRYGMT
LDEEKARILEQARQRALARAWAREQQRVRDGEEGARLWTEGEKRQLLSAGKVQGYDGYYV
LSVEQYPELADSANNIQFLRQSEIGKR
Download sequence
Identical sequences ENSSTOP00000011186 ENSSTOP00000011186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]