SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011234 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011234
Domain Number 1 Region: 1019-1145
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000275
Family GAF domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000011234
Domain Number - Region: 291-359,857-903
Classification Level Classification E-value
Superfamily EF-hand 0.00016
Family Calbindin D9K 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011234   Gene: ENSSTOG00000012528   Transcript: ENSSTOT00000012536
Sequence length 1488
Comment pep:known_by_projection scaffold:spetri2:JH393348.1:6004839:6131835:1 gene:ENSSTOG00000012528 transcript:ENSSTOT00000012536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESPFQEEAKSAQENGKDNKEKKEDSTEETEPIKGSQSLPDVSATETSNHVAEEATDEI
KSQESKLVRQPEIPTSSTKDAIPEVSGNDVIRKPEKVIFSLDETKPKSKLEQPWRKNLLE
RVEASARKIQQKIIDKDNLKKELEKKSEKKLPKDNLAQQWFDTETTTLKTRAYLLDKLLP
TLVPGVEKMLMQLEKKKILTEADTPTKFDPINYLGEYLMRNNPSYVKAPKMSGYQRVMRD
VTEELKVYVPDTICYRVSKMKENVTQKREQRVHINTIKVKVASVRKQALQEQFDEWILDP
RGMIPTIVIQNVLHEFFQKPEFELESHCKQLDFTDSVESGLNKTEFSEYISSHIADLKSE
IFEELLKHLCHCADDFREVVKADLQRQMFADLFLYCDSGKVGVLDRQRTLALLETFYDRL
KRRRKHLLGNPRQWPFVEFEEIDLLEFWGDMDNQKHIYEDFDKVLLRMNALLSEKHDSKT
QNQLSENQQELDEQRKSSLPEQQRVTTAEQGPQRISTAEQEPYEEPDTEQENIPESSTVE
QEPRRESVVEQGSHRSSMVEQEPRRESVTQQGSRRSSMVEQEPRRESVAEQGSHRESVSE
QEHGSRRGSTAGQSQHKGSTAEQGPHKTSFSEYGSRTELTTEEPHTEEHDLYGERIPEKQ
EDVDSTSPSREVRISRTSAESEYIEFPSQEKEQLYEEELLEELQEDLPTSSKKVYLLATT
GKDIQKDRSCEPKSPKIEGKSWSGEFFACNWRRKYVKFEDEDQAHLIYNNSKFTDLHPII
RNIQSYKEIRGRSAFNGVSFNLLQFVQLLETFVGEDAPLSVSESLISFFKRGYFETKEEK
MSALEQVRQKAFQVRRELLLEALFQKWDSDGSGFLDLREVDELLYTYKEGMERECMKKAK
LHFQFPKSYHGHEVKLSSKQFQKYIELVVSELRGNEDQVMESIVEFLMNSLKRSHIEGLR
NCARRKWLHQIQHAAETSGVSVEPVYTETFKTLTQDAEAHGNKKISAHISLLEENELLPD
RGSVLLRNVACTLDDASFVLNRVLYRDMEGISFSVVDEGKPVHVPQVQYHGNIIFWNHSR
NKNDRNGSLLALPLHDAYMRIFGVLAVDTLRDPHKINIFLPHEIRFYQGVANVFSTAYHY
VHSREHILHIVITGIGWLFNVTSNIISITTYFVEPSPHQDSDYVLRNMMVTGKLGLTKIH
TNPPITFRKTCVFRDFLFKCTDSSEVVLASARGETHIVIPLRERTGEALGALDVNIGQTR
MLFYQEYKDLQKMMKVIQAACYEILGEFSGEIKKNIVLEMEKVGEVQRAGIIFFRIMLQE
LQACLKLLSSMDFVTLLLYDHNTQIETTSSKDSKAKELKAHVNLVHDILKGVILFFHTDL
ESEPAKDWDKDKLFVNKYLVESICSFDPTASHVEVNVQLINKYIKGHSRIEVWKFGNTVI
ELLYHWIHVCLALMQLSKKVNNAIIPPLPSKSDSSRYAKMPGEPLPKK
Download sequence
Identical sequences ENSSTOP00000011234 ENSSTOP00000011234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]