SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011371 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011371
Domain Number 1 Region: 23-141
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.7e-40
Family Frizzled cysteine-rich domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 175-283
Classification Level Classification E-value
Superfamily TIMP-like 1.18e-17
Family Tissue inhibitor of metalloproteinases, TIMP 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011371   Gene: ENSSTOG00000012692   Transcript: ENSSTOT00000012691
Sequence length 346
Comment pep:known_by_projection scaffold:spetri2:JH393288.1:13257801:13266737:-1 gene:ENSSTOG00000012692 transcript:ENSSTOT00000012691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSILVALCLWLRLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQ
YEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWP
ESLACDELPVYDRGVCISPEAIVTDLPDDVKWIDITPDMMVQERPLDVDCKRLSPDRCKC
KKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSLSPIPRTQVPLITN
SSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQQRTLQD
KKRTAGRTSRSNPPKPKGKPPAPKPASPKKNIKARSAQKKTNPKRV
Download sequence
Identical sequences ENSSTOP00000011371 XP_005319258.1.77405 ENSSTOP00000011371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]