SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011474 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011474
Domain Number 1 Region: 77-342
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.33e-59
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.046
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000011474
Domain Number - Region: 1-37
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0018
Family PHD domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011474   Gene: ENSSTOG00000012789   Transcript: ENSSTOT00000012801
Sequence length 351
Comment pep:known_by_projection scaffold:spetri2:JH393402.1:4257113:4298758:-1 gene:ENSSTOG00000012789 transcript:ENSSTOT00000012801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCVGVEEHHAVDIDLYHCPNCAVLHGSSLMKKRRNWHRHDYTEVDDGSKPVQAGTRTFVK
ELRSRVFPSADEIIVKMHGNQLTQRYLEKHGFDVPIMVSKLDDLGLRLPPPAFSVMDVER
YVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDI
ARKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLI
KPTNENLALYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMA
FGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLK
Download sequence
Identical sequences ENSSTOP00000011474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]