SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000012631 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000012631
Domain Number 1 Region: 422-550
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.36e-34
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000893
Further Details:      
 
Domain Number 2 Region: 88-168,284-415
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-32
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000703
Further Details:      
 
Domain Number 3 Region: 2-71
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000872
Family Thioltransferase 0.014
Further Details:      
 
Domain Number 4 Region: 89-126,154-276
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000177
Family UDP-galactopyranose mutase, N-terminal domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000012631   Gene: ENSSTOG00000014092   Transcript: ENSSTOT00000014098
Sequence length 552
Comment pep:novel scaffold:spetri2:JH393608.1:1203415:1231785:1 gene:ENSSTOG00000014092 transcript:ENSSTOT00000014098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVKELFSSLGVDCNILELDQLDDGIRVQEMLTEITNQKTVPNIFVNRVHVGGCDRTFQDG
YQRTLVEILIKNHILVGKEMMVCIACEWEAAILGKRVLVLDFVVPSPQGTSWGLGGTCVN
VGCIPKKLMHQAALLGQALQDSRKFGWEYNQQVKHNWSTLTEAIQNHIGSLNWSYRLSLR
EKGVTYVNAYGEFVDHHKIKTREFKVQKTDYYKSIVWPLAVPQAPDLAGLRAVLVDDLFS
LPYCPGKTLVVGASYVALECAGFLAGFGLEVTVMVRSILLRGFDQEMAEKVGSYMERHGV
KFLRKFVPVKIQQLERGSPGKLKVWAKSTEGPETMEEVYNTVLLAIGRDSCTRKLGLEKI
GVKINEKNGKIPVNDTEQTNVPHVYAIGDVLEGKPELTPVAIQAGKLLARRLFGASSEKC
DYMSVPTAVFTPLEYGCCGLSEEKAIEVYKKENLEVYHTLFWPLEWTIAGRDNNTCYAKI
ICHKPDSDRVIGFHILGPNAGEITQGFAAAMKCGLTKQLLDDTIGIHPTCGEVFTTLEIT
KSSGLDITQKGC
Download sequence
Identical sequences ENSSTOP00000012631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]