SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000012655 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000012655
Domain Number 1 Region: 40-74,107-189
Classification Level Classification E-value
Superfamily eIF1-like 1.7e-29
Family eIF1-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000012655   Gene: ENSSTOG00000014128   Transcript: ENSSTOT00000014126
Sequence length 198
Comment pep:known_by_projection scaffold:spetri2:JH393368.1:1854421:1870517:-1 gene:ENSSTOG00000014128 transcript:ENSSTOT00000014126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATDISESSGADGKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKN
FPNEFAKLTVENSPKQEAGINEGQGTVGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKI
PRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQE
KWPEVDDDSIEDLGEVKK
Download sequence
Identical sequences A0A287CTF3
XP_005329629.1.77405 XP_015357924.1.40921 ENSSTOP00000012655 ENSSTOP00000012655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]