SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013248 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013248
Domain Number 1 Region: 664-779,944-997
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000187
Family FAD/NAD-linked reductases, N-terminal and central domains 0.052
Further Details:      
 
Domain Number 2 Region: 462-567
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000629
Family N-acetyl transferase, NAT 0.033
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000013248
Domain Number - Region: 182-253
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000333
Family N-acetyl transferase, NAT 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013248   Gene: ENSSTOG00000014765   Transcript: ENSSTOT00000014788
Sequence length 1236
Comment pep:known_by_projection scaffold:spetri2:JH393295.1:77215:322203:-1 gene:ENSSTOG00000014765 transcript:ENSSTOT00000014788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSILTSPRGKVEVVHCRRTESQDIYCIKKLIRKFTQRLFGKLNIIYLLEKANLAVTLCND
KEEIMAQATFLDYPNWNVSKQDDWVSVFRELDSEIPCTPLNTLFMHLFVAVDEFSTGCCK
EIIRNVFKAVPELHFIFLTVPSYMSLGSTLITVFHQVGTIPNLTYDEDFAVQICLRHNHY
PQLHVRKARVEDHDDLMPIFMHYDTVLKETYGEYFLAELIEAQDEENHAVVCEVEGVAVG
FMSVCSRVNLPLLHQCFDLGPFHGLCVPHPDDILETPQEIDVQEDQDAELMSNRLGVQRI
SGEPEEPLYTEAMENIQEKVLEEAASGEPVLSIQSGISETQEVEKLSRSSIVDEEEQYIS
SESSTSIPLHEEPSYFRPVYKGESDAFCIQLFCIDEKYEARSLDFMNFVFSLFPDKNFCL
ISLPHLTPEFVLIQNFVKIVPYNNCTLEHDLYVFHRAGLLKSIKIRLATLMDTPGIEKLV
RTLMLSESILTDLSQYNEARRDPDGTPMQAFVAEVAEQIVGIAVIRNEMDVEYIRSHYNI
EDFIYFSHHQREEHGHLYHFALNPIFRHYTKFFLKEILRLSYKSCLYYPIYPQPRKGKFQ
NPYAHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKAVSKDPLSYALNHTNRKLTLEPK
ITVNARIVVVGASTVGISFLETLIFCSHLKFNNLTLISTHGLPGKKLLGNEQRKFLATNH
CFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVIVSKDQIVLYDHLILCTGQQYQVPCPT
GADPGQHLTNREVPDSSQLQYAGKVPSNHFILNEEEDCLSALVWIRKQYFPTEGNVIVYG
NTIDAYTTVETLLHIGVKGTCIYLVHPPPESIITCINNYTVESAVEDALNTAGVTIYQDA
VLAQWNDGQYPDPIHSASFTTPTKPFRLTCSMFFSFCEKKVDYETFKALNDACLVYDGRL
VIDTNFHTNDVAIRAAGSLTKFSNRYYSNEWTHSNFSSKEIGFQLAAAMLNLFDPTLEPV
TEPPADLDRLIPMYKGAKIQGGILPGSYHYLHVSKPNIPTPLAVQMSQTNFGSEIITGNV
KNGTYFRIHVNKYKIVETITCLSKEPFPASNYIRLLGQHEQVLNNLCARYDDKLITDLYS
YFTEPWCMALFHDRFIDLRKELRQILASKEEENLPSIEQLAHQIEDEEINLKESPRKYLK
RVFQETIYKNLVERSILDYLHYNHYHLPMYAWPGII
Download sequence
Identical sequences I3MNK3
ENSSTOP00000013248 XP_005320482.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]