SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013287 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013287
Domain Number 1 Region: 460-559
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013287   Gene: ENSSTOG00000014833   Transcript: ENSSTOT00000014835
Sequence length 568
Comment pep:known_by_projection scaffold:spetri2:JH393404.1:4205056:4221056:1 gene:ENSSTOG00000014833 transcript:ENSSTOT00000014835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPDSCCCSPAAMQRRLPILAWLPDYSLQWLKMDFIAGLSVGLTVIPQALAYAEVAGLPP
QYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFHEPAYAVLLAFLSGCIQLAM
GFLRLGFLLDFISCPVIKGFTSAATVTIGFGQIKNLLGLQNIPRQFFLQVYHTFLNIGET
RVGDAVLGLVCMVLLLVLKLMRDHVPPVHPEMPPGVRLSHGLVWTATTARNALVVSFAAL
VAYSFEVTGYQPFVLTGETAEGLPPVRAPPFSLTTANGTTSLAQMVQDMGTGLAVVPLVG
LLESIAVAKAFASQNNYRIDANQELLAIGLTNVLGSLVSSYPVTGSFGRTAVNAQSGVCT
PAGGLVTGALVLLSLDYLTSLFYYIPKAALAAVIIMAVAPLFDTKIFGTLWRVKRLDLLP
LSVTFLLCFWEVQYGILAGTLVSLLILLHAVARPKTQVSEGPVLVLQLASGLHFPAIEAL
REAMLSQALEGSPRRCAVLECTHVCSIDYTVVLGLGDLLEDFRRQGATLVFVGLQVPVLR
TLLAADLKGFQYFSTLEEAGGCRGHSPG
Download sequence
Identical sequences ENSSTOP00000013287 ENSSTOP00000013287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]