SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013520 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013520
Domain Number 1 Region: 1028-1365
Classification Level Classification E-value
Superfamily NHL repeat 4.18e-25
Family NHL repeat 0.001
Further Details:      
 
Domain Number 2 Region: 1262-1469
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.000000144
Family Soluble quinoprotein glucose dehydrogenase 0.03
Further Details:      
 
Domain Number 3 Region: 723-796
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000155
Family Pre-dockerin domain 0.057
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000013520
Domain Number - Region: 467-492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000437
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 564-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00093
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 534-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 435-459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 400-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00261
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 599-639
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00304
Family EGF-type module 0.084
Further Details:      
 
Domain Number - Region: 370-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013520   Gene: ENSSTOG00000015076   Transcript: ENSSTOT00000015087
Sequence length 2569
Comment pep:known_by_projection scaffold:spetri2:JH393432.1:1102733:1441853:-1 gene:ENSSTOG00000015076 transcript:ENSSTOT00000015087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTNPDEEFSPNSYLLRACSGPQQASGSGPPNHHSQSTLRPPLPPPHNHTLSHHHSSANS
LNRNSLTNRRSQIHAPAPAPNDLATTPESVQLQDSWVLNSNVPLETRHFLFKTSSGSTPL
FSSSSPGYPLTSGTVYTPPPRLLPRNTFSRKAFKLKKPSKYCSWKCAALSAIAAALLLAI
LLAYFIAMHLLGLNWQLQPADGHTFNNGIRTGLPGNDDGATLPSGGKVPWSLKNSSIDSG
EAEVGRRVTQEVPPGVFWRSQIHISQPQFLKFNISLGKDALFGVYIRRGLPPSHAQYDFM
ERLDGKEKWSVVESPRERRSIQTLVQNEAVFVQYLDVGLWHLAFYNDGKDKEMVSFNTVV
LDSVQDCPRNCHGNGECVSGLCHCFPGFLGADCAKAACPVLCSGNGQYSKGTCQCYSGWK
GAECDVPMNQCIDPTCGGHGSCIEGNCVCSAGYKGEHCEEVDCLDPTCSSHGVCVNGECL
CSPGWGGLNCELARVQCPDQCSGHGTYLPDSGLCSCDPNWMGPDCSVEVCSVDCGTHGVC
IGGACRCEEGWTGAACDQRVCHPRCIEHGTCKDGKCECREGWNGEHCTIGRQTAGTETDG
CPDLCNGNGRCTLGQNSWQCVCQTGWRGPGCNVAMETSCADNKDNEGDGLVDCLDPDCCL
QTACQNSPLCRGSRDPMDIIQQGQTEWPAVKSFYDRIKLLAGKDSTHIIPGDNPFNSSLV
SLIRGQVVTTDGTPLVGVNVSFVKYPKYGYTITRQDGTFDLIANGGAALTLHFERAPFMS
QERTVWLPWNSFHAMDTLVMKTEENSIPSCDLSGFVRPDPIIISSPLSTFFSAAPGQNPI
VPETQVLHEEIELPGSNVKLRYLSSRTAGYKSLLKITMTQSTVPLNLIRVHLMVAVEGHL
FQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVVSVGFEYETCPSLILWEKRTALLQGF
ELDPSNLGGWSLDKHHILNVKSGILHKGTGENQFLTQQPAIITSIMGNGRRRSISCPSCN
GLAEGNKLLAPVALAVGIDGSLYVGDFNYIRRIFPSRNVTSILELRNKEFKHSNNPAHKY
YLAVDPVSGSLYVSDTNSRRIYRVKSLSGAKDLAGNSEVVAGTGEQCLPFDEARCGDGGK
AVDATLMSPRGIAVDKNGLMYFVDATMIRKVDQNGIISTLLGSNDLTAVRPLSCDSSMDV
AQVRLEWPTDLAVNPMDNSLYVLENNVILRITENHQVSIIAGRPMHCQVPGIDYSLSKLA
IHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNGEICLLAGAASDCDCKNDVNCI
CYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIRAVSKNKPVLNAFNQYEAASPG
EQELYVFNADGIHQYTVSLVTGEYLYNFTYSADNDVTELIDNNGNSLKIRRDSSGMPRHL
LMPDNQIITLTVGTNGGLKVVSTQNLELGLMTYDGNTGLLATKSDETGWTIFYDYDHEGR
LTNVTRPTGVVTSLHREMEKSITIDIENSNRDDDVTVITNLSSVEASYTVVQDQVRNSYQ
LCNNGTLRVMYANGMGVSFHSEPHVLAGTITPTIGRCNISLPMENGLNSIEWRLRKEQIK
GKVTIFGRKLRVHGRNLLSIDYDRNIRTEKIYDDHRKFTLRIIYDQVGRPFLWLPSSGLA
AVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFADGKVWSYSYLDKSMVLLLQSQR
QYIFEYDSSDRLHAVTMPSVARHSMSTHTSIGYIRNIYNPPESNASVIFDYSDDGRILKT
SFLGTGRQVFYRYGKLSKLSEIVYDSTAVTFGYDETTGVLKMVNLQSGGFSCTIRYRKIG
PLVDKQIYRFSEEGMINARFDYTYHDNSFRIASIKPVISETPLPVDLYRYDEISGKVEHF
GKFGVIYYDINQIITTAVMTLSKHFDTHGRIKEVQYEMFRSLMYWMTVQYDSMGRVIKRE
LKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSVRLMPLRYD
LRDRITRLGDVQYKIDDDGYLCQRGSDIFEYNSKGLLTRAYNKASGWSVQYRYDGVGRRA
SYKTNLGHHLQYFYSDLHNPTRITHVYNHSNSEITSLYYDLQGHLFAMESSSGEEYYVAS
DNTGTPLAVFSINGLMIKQLQYTAYGEIYHDSNPDFQMVIGFHGGLYDPLTKLVHFTQRD
YDVLAGRWTSPDYTMWKDVGKEPAPFNLYMFKSNNPLSNELDLKNYVTVSTIDVKSWLVM
FGFQLSNIIPGFPRAKMYFVPPPYELSESQASESGQLITGVQQTAERHNQAFMALEGQVI
SKKLHASIREKAGHWFATTTPIIGKGIMFAIKEGRVTTGVSSIASEDSRKVASVLNNAYY
LDKMHYSIEGKDTHYFVKIGSADSDLVTLGTTIGRKVLESGVNVTVSQPTLLVNGRTRRF
TNIEFQYSTLLLSIRYGLTPDTLDEEKARVLDQARQRALGTAWAKEQQKARDGREGSRLW
TEGEKQQLLSSGRVQGYEGYYVLPVEQYPELADSSSNIQFLRQNEMGKR
Download sequence
Identical sequences ENSSTOP00000013520 ENSSTOP00000013520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]