SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013629 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013629
Domain Number 1 Region: 1-224
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.78e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0031
Further Details:      
 
Domain Number 2 Region: 315-488
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.06e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013629   Gene: ENSSTOG00000015207   Transcript: ENSSTOT00000015210
Sequence length 535
Comment pep:novel scaffold:spetri2:JH393763.1:100811:132842:-1 gene:ENSSTOG00000015207 transcript:ENSSTOT00000015210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKKRICVIGAGASGLCSIKCCLDEDLEPVCFERTDDIGGLWRYQENPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNSQILEYFRMYAKDFNLLKYIQFKTTVCSVKKRPDF
STSGQWEVVTECEGKKEANVFDGVMVCTGHHTNAHLPLESFSGIEKFRGQYFHSRDYKNP
EAFAGKRVIIIGIGNSGGDLAVEISHTAKQVFLSTRRGAWILNRVGDHGYPFDVVHSSRF
KYLISKICGQALTSTFLEKRMNQRFDHEMFGLKPKHRHRALSQHPTVNDDLPNRIISGLV
KVKGNVKEFTETAAIFEDGSREDDIDVVIFATGYSFAFPFLEDSIKVVKNKISLYKKVFP
PNLEKPTLAIIGLIQPLGAIMPIAELQGRWATQVFKGLKKLPSQSEMMADISKTQEEMAK
RYVESQRHTIQGDYIDTMDQIADLMGVKPNLLSLAFTDPKLALQLFWGPCTPAQFRLQGP
GKWDGARKTILTTHDRIRKPMKTRVIEKNNSIALTKTMGRIMLAVIFFAVIMAYF
Download sequence
Identical sequences ENSSTOP00000013629 ENSSTOP00000013629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]