SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013884 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013884
Domain Number 1 Region: 3-221
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.18e-75
Family Ubiquitin carboxyl-terminal hydrolase UCH-L 0.00000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013884   Gene: ENSSTOG00000015507   Transcript: ENSSTOT00000015509
Sequence length 223
Comment pep:known_by_projection scaffold:spetri2:JH393292.1:8551820:8563244:1 gene:ENSSTOG00000015507 transcript:ENSSTOT00000015509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLKPMEINPEMLNKVLARLGVAGQWRFADVLGLEEDALGSVPAPACALLLLFPLTAQHE
NFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSE
TEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMP
FPVNHGTSSEGSLLQDAAKVCREFTEREQGEVRFSAVALCKAA
Download sequence
Identical sequences A0A287D239
XP_005319998.1.77405 ENSSTOP00000013884 ENSSTOP00000013884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]