SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013925 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013925
Domain Number 1 Region: 19-196
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.01e-69
Family MHC antigen-recognition domain 0.000000111
Further Details:      
 
Domain Number 2 Region: 199-291
Classification Level Classification E-value
Superfamily Immunoglobulin 2.89e-28
Family C1 set domains (antibody constant domain-like) 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013925   Gene: ENSSTOG00000015560   Transcript: ENSSTOT00000015559
Sequence length 353
Comment pep:novel scaffold:spetri2:JH393533.1:403524:406303:-1 gene:ENSSTOG00000015560 transcript:ENSSTOT00000015559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLMLSGALALTETWAGSHSMRYFEISVSRPGGEPWHMEVGYVDDTQFVRFDSDAPTPK
MEPRAPWIEQEGPGYWERNTRIAKGNAQSDQVGLNTLRGYYNQSAAGSHTYQTTYGCDVG
TDGRLLRGYSQFAYDGADYIALNDDLRSWTAADTAAQITRRKWEEGGYAEQERAYLEGCV
RSLARYLELGKETLLRTDPPKTHVTHYPRPEGDVTLRCWALGFYPKEITLNWQRDGEDQT
QDMELVETRPAGDGNFQKWAAVVVRAGEEQRYTCHVHHEGLPEALTLRWEPPSQPNILIM
VIVAGVVLFGAFVARAVISFVSWRKKNTGVKKGPYAPAICNNSAQGSDVSLTA
Download sequence
Identical sequences ENSSTOP00000013925 ENSSTOP00000013925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]