SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014410 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014410
Domain Number 1 Region: 56-253
Classification Level Classification E-value
Superfamily GAF domain-like 4.91e-32
Family GAF domain 0.00036
Further Details:      
 
Domain Number 2 Region: 238-283,310-421
Classification Level Classification E-value
Superfamily GAF domain-like 4.91e-20
Family GAF domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014410   Gene: ENSSTOG00000016096   Transcript: ENSSTOT00000016098
Sequence length 423
Comment pep:novel scaffold:spetri2:JH393411.1:1373245:1393377:-1 gene:ENSSTOG00000016096 transcript:ENSSTOT00000016098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEINKNAVEKYLEENPAFAKEYFDKKLRVEVLGEIFKNSRVPVQASMSLPELTQVEESA
VCLELLWSVQEEGSSAELTAHKVLQRMAQLLQADRCSMFICRSRNGTPEMASKLLDITPT
SKFEDNLVVPDKEVVFPLDVGIVGWVAHTKKPLNVPDVKKNNHFSDVMDKQTGYVTKNLL
AAPVVMGKEVLAVLAAVNKVNASEFSKQDEEVFTKYLNFVSVILKLHHTNYLYNIESRRS
QILMWSANKVFEELTDVERQFHKALYTIRTYLNCERYSIGLLDMTKEKEFYDEWPIKLGE
VEPYKGPKTPDGREVIFYKVIDYILHGKEEIKVIPTPPADHWTFVSGLPTYVAENGFICN
MLNAPADEYFTFQKGPVDETGWVIKHVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEH
ITE
Download sequence
Identical sequences ENSSTOP00000014410 ENSSTOP00000014410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]