SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014550 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014550
Domain Number 1 Region: 436-494
Classification Level Classification E-value
Superfamily EF-hand 0.0000123
Family Calbindin D9K 0.028
Further Details:      
 
Domain Number 2 Region: 188-283
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0001
Family Coronavirus S2 glycoprotein 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000014550
Domain Number - Region: 98-177
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0575
Family HBL-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014550   Gene: ENSSTOG00000016250   Transcript: ENSSTOT00000016252
Sequence length 496
Comment pep:known_by_projection scaffold:spetri2:JH393284.1:27672272:27705646:-1 gene:ENSSTOG00000016250 transcript:ENSSTOT00000016252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKRRELNALIGLSGDSRRKKPKKGSSSHRLLRTEPPDSDSDSSSEEEEEFGVVGNRSRF
VKGDYLRCCKICYPLCAFVILAACVVACVGLVWMQVALKEDLDILKERFRTMESNQKSSF
QEIPKLNEELLSEQKQLEKIESGELGLNDVWLNITEMNKQISLLTSAVNHLKANVKSAAD
LISLPTTVEGLQKSVASIGNTLNSVHLAMEAIQKTVDEHKKTVELLQSDMNRHFSNWTNG
SNKIIPAPSATSELDNKTHSENLKQDILYLHNSLEAVNSTLVAYQRQNDLKLEGMNETLS
NLIQRTNLIESNVVFALSEVENTTNFLPSKVSDRAAILKRESLDQGANRTDIIKTQNIKK
EESPNSQVSKLREKLQLISALTNKPESNRPPEIADEEQVQSFTSKPSTLPKFSQFLGDQI
EKTAQLRPVSLPGISSIEDLQDLFHKTGQDVDGKLTYQEIWNSLGSTLPDPESLRAFDSN
GDGRYSFLELRVALGV
Download sequence
Identical sequences ENSSTOP00000014550 ENSSTOP00000014550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]