SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014687 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014687
Domain Number 1 Region: 167-297
Classification Level Classification E-value
Superfamily ApaG-like 4.32e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 4-152
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.44e-18
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000014687
Domain Number - Region: 305-338
Classification Level Classification E-value
Superfamily ARM repeat 0.00748
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014687   Gene: ENSSTOG00000016405   Transcript: ENSSTOT00000016408
Sequence length 357
Comment pep:known_by_projection scaffold:spetri2:JH393343.1:4200760:4231944:1 gene:ENSSTOG00000016405 transcript:ENSSTOT00000016408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSLKEGAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSED
LLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNP
AAIDMFIIGATFTDWFTSYVNNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFL
PELSSVHPPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFP
IISPGRVYEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARL
EMGPDEYEEMEEEEEEEEEEDDDESADMDESDEDEEEERRRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences ENSSTOP00000014687 ENSSTOP00000014687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]