SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014716 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014716
Domain Number 1 Region: 44-229,353-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.7e-51
Family FAD-linked reductases, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014716   Gene: ENSSTOG00000016439   Transcript: ENSSTOT00000016442
Sequence length 476
Comment pep:known_by_projection scaffold:spetri2:JH393298.1:3217806:3233775:1 gene:ENSSTOG00000016439 transcript:ENSSTOT00000016442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVARVSVMAARVSRTGWAIAFTAARRSPLISCRRCSSVSADTVYDVVVSGGGLVGAAMAC
ALGHDIHFRDKKILLLEAGPKRVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRY
RAFRRMQVWDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLEAVSDRVTVLYRSKAV
GYTWPGPFSMADSSPWVHITLGDGSTLQTKLLIGADGYNSGVRQAAGIQNVSWNYDQSAV
VATLHLSEATENNVAWQRFLPSGPIALLPLSDTLSSLVWSTSHDHAAELVSMDEEEFVDA
INSAFWSDANHVDFIDSAGTMLQYVVTLLKPTKVSARQLPPSVAKVDAKSRVLFPLGLGH
AAEYVRPRVALIGDAAHRVHPLAGQGVNMGFGDISSLVHHLSTAAFNGKDLGSMSHLASY
ETDRQRHNTALLAATDLLKRLYSTRAPPLVLLRTWGLQATNAMSPLKEQIMAFASK
Download sequence
Identical sequences A0A287D0H8
ENSSTOP00000014716 XP_005321278.1.77405 ENSSTOP00000014716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]