SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014720 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000014720
Domain Number - Region: 62-128
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 0.00344
Family CCP-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014720   Gene: ENSSTOG00000016444   Transcript: ENSSTOT00000016447
Sequence length 275
Comment pep:novel scaffold:spetri2:JH393353.1:1944660:1948412:-1 gene:ENSSTOG00000016444 transcript:ENSSTOT00000016447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTDLRMLGLAARPRGVQSWWLVLLLLQLIGVPPGTGLGSCIPSPVPFPEHISYVPRLSSV
TLAGKLTQSTFTLEQPLGLFDDLNISNSDPIWLVVAHSNAIQNFTVPQRTKDIPAPADFS
QKGYYLTLRANQKLYQRGGQASKQLPVLRVGNDTHCSWTKVGCNHPLQGSGPYRVKFLVM
NKEGPVAETEWSKETRLQQAQVLQAVTGPQSAGTVVIIAILSVLLAILLAAVLIMLTQAY
CESCRNVPVPIPEEPLSMGRYSTHHMGDPSAVGGS
Download sequence
Identical sequences ENSSTOP00000014720 ENSSTOP00000014720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]