SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014988 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014988
Domain Number 1 Region: 547-667
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.35e-16
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014988   Gene: ENSSTOG00000020554   Transcript: ENSSTOT00000019838
Sequence length 683
Comment pep:known_by_projection scaffold:spetri2:JH393456.1:1763672:1770198:1 gene:ENSSTOG00000020554 transcript:ENSSTOT00000019838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEGVKDKMSGLLGARTCSSPGEASDLKYPLGTRLREPLTEARFQQLFRDEEQVQELPTEP
RGPRLCRMWRRPASACSRRGAWRLLQARLPPLRWLPLYRWRAWLLGDAVAGVTVGVVHVP
QGMAFALLTSVPPVFGLYTSFFPVLIYSLLGTGRHLSTGTFAVLSLMTGSAVERLVPEPL
SRNLSGIEKEQLDAQRVGAAAAVAFGSGALMLGMFVLQLGVLSTFLSEPVVKALTSGAAL
HVLVSQLPSLLGLSLPRQIGCFSLFKTLAAVLTSLPRSSPAELTISALSLALLVPVKELN
VRFRDRLPTPIPGEIVMVLLASVLCFTSSLDTKYNVQIVGLLPEGFPQPLLPSLAELPRI
LADSLPIALVTFAVSASLASMYADKYNYTIDPNQELLAHGVSNLISSFFSCFPNSASLAT
TSLLVDAGGNTQLAGLFSCIVVLLVLLWLGPFFYYLPKAVLACINISSMRQMFFQMQELP
QLWHISRMDFAVWIVTWVAVVTLNVDLGLAVGVIFSMMTVVCRTQRVQCLALGLAEGTEL
YRPLRESHRLLQVPGLCILRYPTPLYFGTRGNFRRILEWHLGLGEGGKVIAEPVRVVVLD
FSGVTFADAAGAREVAQLASRCRDVGIHLLLAQCNASVLETLARAGVLDRVTPQQLFVSV
QDAAAHALEKLELTGSTICTVWI
Download sequence
Identical sequences ENSSTOP00000014988 ENSSTOP00000014988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]