SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015141 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015141
Domain Number 1 Region: 82-214
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 0.00000000000000249
Family Aldo-keto reductases (NADP) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015141   Gene: ENSSTOG00000023724   Transcript: ENSSTOT00000024524
Sequence length 274
Comment pep:known_by_projection scaffold:spetri2:JH393665.1:288294:289263:-1 gene:ENSSTOG00000023724 transcript:ENSSTOT00000024524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGTDSRAAGALLARARTLHLQTGDLLNWGRLRKKCPSTHSEELRDCIQKTLNEWSSQISP
DLVREFPDVLECTVSHAVEKINPGEREEMKVSAKLFIVGSNSSSSTRNAIDMACSVLGVA
QLDSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQ
VKPNSNQENLASCCVMPPDITAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAH
EWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS
Download sequence
Identical sequences ENSSTOP00000015141 ENSSTOP00000015141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]