SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015171 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015171
Domain Number 1 Region: 33-274
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.07e-66
Family LplA-like 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015171   Gene: ENSSTOG00000027199   Transcript: ENSSTOT00000027613
Sequence length 373
Comment pep:known_by_projection scaffold:spetri2:JH393471.1:1640324:1641442:-1 gene:ENSSTOG00000027199 transcript:ENSSTOT00000027613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIPFSVKNCFQLLCNHKIPAAGFKNTTKGGLILQSISNDVYQNLAVEDWIHDHVNLEGK
PILFFWRNSPCVVIGRHQNPWQECNLNLMRKEGIKLARRRSGGGTVYHDMGNINLTFFTT
KKKYDRMDNLKLIVRALNAVQPQLDVQATKRFDLLLDGQFKISGTASKIGRTTAYHHCTL
LCSTDGTSLSSSLKSPYQGIKSNATTSIPSLVKNLLEKDPTLTSEVLMNAIAAEYAAYHQ
IDNHINLINPTDETLFPGINSKAKELQTWEWIYGKTPKFSIDTTLDVLYEQSHLEIKLFI
DIKNGRIEICNIEAPDHWIPLAICDKLNSSFIGSKFCPTETTMLTNILLRTYPEDHELHS
KWDILCEKIRGIM
Download sequence
Identical sequences ENSSTOP00000015171 XP_005336448.1.77405 XP_013218858.1.77405 ENSSTOP00000015171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]