SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015574 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000015574
Domain Number - Region: 35-103
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00199
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015574   Gene: ENSSTOG00000028971   Transcript: ENSSTOT00000024715
Sequence length 181
Comment pep:known_by_projection scaffold:spetri2:JH393390.1:5269451:5277370:-1 gene:ENSSTOG00000028971 transcript:ENSSTOT00000024715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLAFVALLAVTHAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDD
SFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVV
GSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKTKK
N
Download sequence
Identical sequences I3MTX9
ENSSTOP00000015574 ENSSTOP00000015574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]