SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015818 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015818
Domain Number 1 Region: 538-566,610-690
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.67e-16
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015818   Gene: ENSSTOG00000029038   Transcript: ENSSTOT00000021047
Sequence length 704
Comment pep:known_by_projection scaffold:spetri2:JH393287.1:22209810:22212654:1 gene:ENSSTOG00000029038 transcript:ENSSTOT00000021047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAPESPQQGRGLVLVRRQPPAQKGPLERLKARLWRSCTCSVPRAWALVQSLVPATCWL
REYRPREDLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRH
VNVGIFSLLCLMVGQVVDRELQLAGFDPSQDGLGPQGNSSILNSSTTSLVLGPPGCGRDC
HAIRVATALTLVAGIYQVLMGVLRLGFVSTYLSQPLLDGFAMGASVTILTSQLRHMLGVR
VPRHQGPGMVISTWLSLLRSLAQANLCDVATSAVCLAVLLAAKELSDRCRHRLKVPLPTE
LLVIVVATLVSHFGQLHRRFGSSVAGDIPTGFVAPQAPDPRLMQRVALDAVSLALVGSAF
SISLAEMFARSHGYSVRANQELLAVGCCNVLPAFFHCFATSAALSKSLVKTATGCRTQLS
SVVSAAVVLLVLLVLAPLFWDLQRSVLACIIVVSLRGALRKVRGLPRLWRLSPADALVWV
ATAATCVLVTTEAGLLAGVLLSLLSLAGRTQRPRAALLARIGDSAFYEDATEFEGLVPQP
GVQVFRFAGPLYYANKDFFLRSLYSLTGLDAGRSAATRRERGSEMGAGEGEPVDGKDLGS
MTSRARLVPMVTGFHTVVIDCAPLLFLDVAGMATLKDLRRDYWALGVTLLLACCNPSVRD
SLKRGGFLSEDQGPEDEQLFPSVHSAVEAARARRGELVVPDSAL
Download sequence
Identical sequences I3MUM3
ENSSTOP00000015818 ENSSTOP00000015818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]