SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015907 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015907
Domain Number 1 Region: 65-368,535-570
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.91e-51
Family FAD-linked reductases, N-terminal domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015907   Gene: ENSSTOG00000026131   Transcript: ENSSTOT00000029471
Sequence length 610
Comment pep:known_by_projection scaffold:spetri2:JH393522.1:1826923:1836308:1 gene:ENSSTOG00000026131 transcript:ENSSTOT00000029471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLSLVLLLVLLLLAGVRRVYLGLFAGRSPNPFLQDVKRPPAPLVTDKEARKRVLKQVFS
ASQVPENLDVVVIGSGIGGLAAAAILAKAGKRVLVLEQHTKAGGCCHTFGKNGLEFDTGI
HYIGHMEEGTFGRFILDQITEGQLDWASLSSPFDTVVLDRPSGRKEFPMYSGKKAYIEGL
KEKFPQEKDVIDKYIKLVKVVADGSIHAILLKFLPLCVAQLLSKCGLLTRFSPFLHASTQ
SLAEVLQQLGASPELQAVLSYIFPTYGVTPSRTTFSMHALLVNHYLQGAFYPRGGSSEIA
FHIIPVIKQAGGAVLTKATVQTVLLDSAGKACGVRVKKGQELVDIYCPTVVSNAGLFNTY
EHLLPESARCLSGVQQQLQMVRPGLSMFSVFICLHGTKEELGLQSTNYYVYFDINMDKAM
ERYISMPREKAVEHIPLYFIASPSSKDPTWPGRFPDRSTLTVLIPTAYEWFEEWQEEPQG
KRSHDYETLKSSFVEASISVVLRLFPQLEGKVESATGGSPLTNQFFLAATRGATYGADHD
LDRLHPYVMASIRAQSPIPNLYLTGQDIFTCGLMGALQGALLCSSAILKRNLYSDLKDLG
SRVRAQKKMM
Download sequence
Identical sequences I3MUW2
XP_005338514.1.77405 ENSSTOP00000015907 ENSSTOP00000015907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]