SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016050 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016050
Domain Number 1 Region: 34-89
Classification Level Classification E-value
Superfamily BPTI-like 6.1e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016050   Gene: ENSSTOG00000005749   Transcript: ENSSTOT00000021581
Sequence length 89
Comment pep:novel scaffold:spetri2:JH393324.1:7447587:7449617:-1 gene:ENSSTOG00000005749 transcript:ENSSTOT00000021581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRLCLSAALLVLLAILVVGTSSQVEESKLFKNAPPAFCLEPPYTGPCRASIRMFFYNAN
SGRCETFVFGGCRRRKNAFMEEEECMRVC
Download sequence
Identical sequences ENSSTOP00000016050 ENSSTOP00000020147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]