SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016252 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016252
Domain Number 1 Region: 57-169
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.97e-38
Family Frizzled cysteine-rich domain 0.0000996
Further Details:      
 
Domain Number 2 Region: 188-312
Classification Level Classification E-value
Superfamily TIMP-like 2.75e-20
Family Netrin-like domain (NTR/C345C module) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016252   Gene: ENSSTOG00000024513   Transcript: ENSSTOT00000024100
Sequence length 318
Comment pep:known_by_projection scaffold:spetri2:JH393595.1:1276699:1317553:1 gene:ENSSTOG00000024513 transcript:ENSSTOT00000024100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGHGAGGRRWAASGVLLALAAGLLAAGTASEYDYVSFQSDIGSYQSGRFYTKPPQCVD
IPVDLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHIGTQVFLCSLFAPV
CLDRPIYPCRWLCEAVRDSCEPVMQFFGFFWPEMLKCDKFPEGDVCIAMTPPNATEASKP
QAGHSGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIIPKKKKPLKLG
PIKKKELKKLVLFLKNGADCPCHQLDNLSHHFLIMGRKVKNQYLLTAIHKWDKKNKEFKN
FMKKMKNHECPTFQSVFK
Download sequence
Identical sequences ENSSTOP00000016252 ENSSTOP00000016252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]