SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016258 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016258
Domain Number 1 Region: 28-336,422-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.7e-64
Family FAD-linked reductases, N-terminal domain 0.00000458
Further Details:      
 
Domain Number 2 Region: 321-433
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.42e-33
Family L-aminoacid/polyamine oxidase 0.0000474
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016258   Gene: ENSSTOG00000027829   Transcript: ENSSTOT00000029996
Sequence length 499
Comment pep:novel scaffold:spetri2:JH393549.1:1967846:1974279:-1 gene:ENSSTOG00000027829 transcript:ENSSTOT00000029996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDLVKCFEDPQYEELLQLAQDGLGPTAEKKRIVVIGAGMAGLTAAKILQDAGHQVTVLEA
SGRVGGRIETHRVPGTQLYIELGAMRIPINHRLCHEFIRKLGLTLKEYFPSNNQTWVLIN
GVRQRTGIVQADPSLLEYSVKADEVGKTGDQLFHEALRKAKLVEELKNSSCSQILEKYDS
FSTKEYLIKVGDLSRGAVQMIGDLLNTDSGYYESFIETLRDLIIFSQESRFHEIVGGFDQ
LPQALHGALLPGTVLFHSPAEEVEMSGDHVHVTFRTADPLQPRSRLTADFVVVATTVKAA
RLLRFRPPLSLNKENSLRSVHYTSATKVILACTQRFWEQEGIFGGKSCTDRPARFIYYPS
HTFPNGTGVILASYTVSDDSMFFAAMDDAQVVDVILDDLAAVHDRPKEQLRALCPYSMVK
HWSQDPYSLGAYTSFTPYQYVDYAQELSHPEGRVHFAGEHTALTHGWIDTAIKSGLRAAK
SIQESVDLALTKDPGDTKK
Download sequence
Identical sequences ENSSTOP00000016258 ENSSTOP00000016258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]