SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016343 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016343
Domain Number 1 Region: 6-141
Classification Level Classification E-value
Superfamily Globin-like 6.15e-49
Family Globins 0.000000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016343   Gene: ENSSTOG00000022777   Transcript: ENSSTOT00000026609
Sequence length 141
Comment pep:novel scaffold:spetri2:JH393926.1:185071:189499:1 gene:ENSSTOG00000022777 transcript:ENSSTOT00000026609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGKPAIDVLWGKMNVDEVGGEALGRLLVVYPWTQRFFDAFGDLSSASAVMGNAKVKAHGK
KVIDSFSNGLKHLDNHKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPE
AQAAFQKVVAGVANALSHKYH
Download sequence
Identical sequences ENSSTOP00000016343 ENSSTOP00000016343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]