SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016400 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000016400
Domain Number - Region: 33-84
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00942
Family Cold shock DNA-binding domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016400   Gene: ENSSTOG00000027793   Transcript: ENSSTOT00000026715
Sequence length 237
Comment pep:novel scaffold:spetri2:JH393323.1:11473810:11486128:1 gene:ENSSTOG00000027793 transcript:ENSSTOT00000026715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRILRRFMAFFQRRENPNRHLGLPQAILCDTKLKTVQGVVTSLCDDYGLIDESIYFSTN
IVTENVPLKIGQKVTAVVEEDKTSEINQVDVIPDNFDVTKPLDSRIRVLVGYVTCIKKDT
VYIDKKTYFSIDIVSEGFVPYKGDWLEVEYSTQPGTSNIKAHSVKPMNCKHVDEVCITSL
QERHGMIDYTIFFTLDSLKLPDGYVPQPYDVVNVVIVESVQLCCVWRAVSMTPVQRS
Download sequence
Identical sequences ENSSTOP00000016400 ENSSTOP00000016400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]