SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017213 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017213
Domain Number 1 Region: 56-284
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.7e-92
Family Fibrinogen C-terminal domain-like 0.000000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017213   Gene: ENSSTOG00000022196   Transcript: ENSSTOT00000020843
Sequence length 289
Comment pep:known_by_projection scaffold:spetri2:JH393424.1:431634:449034:-1 gene:ENSSTOG00000022196 transcript:ENSSTOT00000020843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDCFQEQERLRAQVRRLETRVKQQQVRIAQLLRDKEVQFLDRGEENSIIDLGGKRQYADC
SEIFNDGYKRNGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSEDFNRGWNDYENG
FGNFVQKNGEYWLGNKNLHLLTTQGDYTLKIDLTDFEKNSSYAQYKNFKVGNEKNSYDLH
IGEYSGTAGDSLAGNFHPEVQWWASHQSMKFSTWDRDNDNYEGNCAKEEQSGWWFNRCHS
ANLNGVYYKGPYTAETDNGVVWYTWHGWWYSLKSVVMKIRPNDFIPNIV
Download sequence
Identical sequences ENSSTOP00000017213 ENSSTOP00000017213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]