SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017372 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017372
Domain Number 1 Region: 1574-1816
Classification Level Classification E-value
Superfamily Ankyrin repeat 8e-54
Family Ankyrin repeat 0.00000123
Further Details:      
 
Domain Number 2 Region: 501-632
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000612
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 918-1051
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000235
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 276-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000162
Family EGF-type module 0.017
Further Details:      
 
Domain Number 5 Region: 678-810
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000314
Family Growth factor receptor domain 0.0053
Further Details:      
 
Domain Number 6 Region: 158-202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000781
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 194-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000821
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 8 Region: 359-480
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000832
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 9 Region: 809-934
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000235
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 10 Region: 1253-1284
Classification Level Classification E-value
Superfamily Notch domain 0.00000017
Family Notch domain 0.0024
Further Details:      
 
Domain Number 11 Region: 236-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000248
Family EGF-type module 0.026
Further Details:      
 
Domain Number 12 Region: 1047-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000347
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 314-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000159
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 14 Region: 66-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000162
Family EGF-type module 0.018
Further Details:      
 
Domain Number 15 Region: 31-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000041
Family EGF-type module 0.02
Further Details:      
 
Domain Number 16 Region: 120-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000895
Family EGF-type module 0.022
Further Details:      
 
Domain Number 17 Region: 1216-1246
Classification Level Classification E-value
Superfamily Notch domain 0.000011
Family Notch domain 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000017372
Domain Number - Region: 1134-1172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000266
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 626-657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00225
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 1175-1204
Classification Level Classification E-value
Superfamily Notch domain 0.00235
Family Notch domain 0.0034
Further Details:      
 
Domain Number - Region: 1089-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 480-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family EGF-type module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017372   Gene: ENSSTOG00000028306   Transcript: ENSSTOT00000020230
Sequence length 1959
Comment pep:known_by_projection scaffold:spetri2:JH393537.1:1386618:1408376:1 gene:ENSSTOG00000028306 transcript:ENSSTOT00000020230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPSLLLLLLLPPPPCFLVVMARGLLCGSFPEPCANGGTCLTLPQGQETCLCAPGFLGK
TCKFPDPCQDAQLCQNGGSCQTLLPTSPGSSSSPSPLPPSFFCNCPTGFTGKRCQVRLQD
PCLPSFCSKRGRCHIQASGRPQCTCMPGWTGEQCQLRDFCSANPCINGGVCLATYPQIQC
RCPPGFEGHACQHDVNECFQDPGLCPKGTSCLNTLGSYQCLCPAGREGPHCELRTGPCPL
AGCSNGGTCQLVPGGDTTFHFCLCPPGFTGLDCEVNLDDCIEHHCQNGGICQDGLGTYTC
LCPETWTGWDCSEDVDECEVHGSPHCKNGGTCQNLPGSFHCVCVSGWGGTGCEENLDDCV
AATCAPGSTCIDHVGFFSCLCPPGRTGLLCHLEDMCLSQPCHGEAQCSTNPLTGSTLCLC
QPGYSGPTCHQDLDECQMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECL
SQPCHPGSTCLDLLATFHCLCPPGLEGLLCEVETNECASAPCLNQADCHDLRNGFLCVCQ
PGFTGTQCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPQCETEVDECLSSPCPS
GASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPEQKCQDQENKIHCLCPSGSLGCAP
AEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGACISIPCAHGGTCYPQPSGYNCTCPTG
YTGPTCSEEVTACHSEPCLNGGSCSPSPGGYSCICLPSHTGSHCQTIIDHCVSAPCLNGG
TCVNRTGTFSCLCSVGFQGPHCEGRIHSSCADSPCRNRATCQDGPQGPRCLCPPGYTGES
CQTLMDLCAQKPCPHNAHCLQSGPSFQCLCLQGWTGPLCNIPQSSCQKAALSQGIEVSAL
CQNGGLCIDRGPSYFCHCPPGFQGSLCQDNINPCESRPCQNGATCVAQPNGYLCQCAPGY
NGQNCSKEIDACQSQPCHNHGTCTPILGGFNCACPPGFVGLRCEGDVDECLDKPCHPTGT
AACHSLANAFYCQCLPGHTGQWCEVEIDPCQSQPCSHGGSCEVTAGPPRGFTCHCPQGFE
GPTCGHRVPSCGIYHCHHGGLCLPSPKPGFPPRCACLNGFEGPDCLTPPAPQGCGPPSPC
LHNGSCSETPGLGGPGFRCSCPPDSPGPRCQRPGAKGCEGRSGDGACDTGCSGPGGNWDG
GDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCEPPPSCTPAYDQYCR
DHFHNGHCEKGCNTAECGWDGGDCRPEDGDLEWGPSLALLVVLSPTALDQQLLALARVLS
LTLRVGLWVRKDSNGRDMVFPYPGSRAEEELRGTHDPSHAEEADPDMQLLGKEKDSLSAG
FVVVMGVDLSHCGPDHPASRCPWDSGLLLRFLAAMAAVGALEPLLPAPLLAAHPHTGSAP
TKQLPWTMLCSPVAGVLLLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQQTPRRRR
PPLGEDSIGLKELKPEAEVEEDGVVMCSGPEEEEAEEMAPPSKCQLWPLSGGCGELPQVA
MLTPPQESEIEVSDVNACGPDGVTPLMSAVCCGRVESRTFQGAWLGSPEPWELLLDGGAC
PQAHTVGTGETPLHLAARFSRPTAACRLLEAGANPNQPDRAGRTPLHAAVAADAREVCQL
LLGSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAAVN
NARAARSLLQAGADKDAQDSREQTPLFLAAREGAMEVAQLLLGLGAARGLRDQAGLAPSD
IARQRNHWDLLTLLEGAGPPEARTASGSVPAHAGGAVPRCRTLSAGAGQRGGGACQQSRT
LSVDLAPRGARAYPHCRSLSGGGAGGPPSRSRRFSAGMRGSRGGRTVADDWPCDWVTLET
CGPSPNIPIPPPCLTPSPERGSPQVVWGLPVQQVIPLNS
Download sequence
Identical sequences ENSSTOP00000017372 ENSSTOP00000017372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]