SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017503 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017503
Domain Number 1 Region: 73-151
Classification Level Classification E-value
Superfamily ACP-like 5.89e-18
Family Acyl-carrier protein (ACP) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017503   Gene: ENSSTOG00000024657   Transcript: ENSSTOT00000028301
Sequence length 156
Comment pep:known_by_projection scaffold:spetri2:JH393311.1:8234027:8240638:-1 gene:ENSSTOG00000024657 transcript:ENSSTOT00000028301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARVLSSCVRRLPAAFAPLPRVPVPALARPLSTALCPAGNRTWPGTTQLALVLTQVPGR
VTQLCRQYSDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIM
AMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
Download sequence
Identical sequences I3MZF7
XP_005323808.1.77405 ENSSTOP00000017503 ENSSTOP00000017503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]