SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017881 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000017881
Domain Number - Region: 10-80
Classification Level Classification E-value
Superfamily Prefoldin 0.0732
Family Prefoldin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017881   Gene: ENSSTOG00000028416   Transcript: ENSSTOT00000021545
Sequence length 186
Comment pep:known_by_projection scaffold:spetri2:JH393331.1:6131029:6141568:-1 gene:ENSSTOG00000028416 transcript:ENSSTOT00000021545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLENLKEQLAPLEKVRIEIS
RKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMT
RQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLR
QIGEKD
Download sequence
Identical sequences ENSSTOP00000017881 ENSSTOP00000017881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]