SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018075 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018075
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 1.08e-53
Family Globins 0.000000391
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018075   Gene: ENSSTOG00000020876   Transcript: ENSSTOT00000021189
Sequence length 147
Comment pep:novel scaffold:spetri2:JH393926.1:177815:179237:1 gene:ENSSTOG00000020876 transcript:ENSSTOT00000021189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHFTAEDKAAITSMWRKVNVEEAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPK
VKAHGKKVLTSLGNALRDMDDLKGAFSQLSELHCERLHVDPENFRLLGNMLVIIMAKHFG
KEFTPEMQASWQKMVAGVASALAHKYH
Download sequence
Identical sequences I3N129
ENSSTOP00000018075 ENSSTOP00000018075 XP_005342579.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]