SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018220 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018220
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.57e-39
Family Dual specificity phosphatase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018220   Gene: ENSSTOG00000026975   Transcript: ENSSTOT00000027368
Sequence length 238
Comment pep:known_by_projection scaffold:spetri2:JH393295.1:18818794:18827543:-1 gene:ENSSTOG00000026975 transcript:ENSSTOT00000027368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNGMTKVLPGLYLGNFIDAKDPDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPE
VPIKKHFKECISFIHCCRLNGGNCLVHCFAGISRSTTIVTAYVMTVTGLGWREVLEAIKA
TRPIANPNPGFRQQLEEFGWGNSRKLRRQLEERFGESPFRDEEDVRALLPLCKRCRQGSA
ASAASAAPTPPHSSASEGTLQRLVPRTTRDAHRSLPLLARVKQTFSCLPRCLSRKGGK
Download sequence
Identical sequences I3N1H4
XP_005320640.1.77405 ENSSTOP00000018220 ENSSTOP00000018220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]