SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018306 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018306
Domain Number 1 Region: 753-981
Classification Level Classification E-value
Superfamily vWA-like 1.53e-49
Family Integrin A (or I) domain 0.00043
Further Details:      
 
Domain Number 2 Region: 45-226
Classification Level Classification E-value
Superfamily vWA-like 1.63e-30
Family Integrin A (or I) domain 0.0025
Further Details:      
 
Domain Number 3 Region: 1065-1121
Classification Level Classification E-value
Superfamily BPTI-like 1.02e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018306   Gene: ENSSTOG00000023884   Transcript: ENSSTOT00000026598
Sequence length 1123
Comment pep:known_by_projection scaffold:spetri2:JH393395.1:2387333:2546363:1 gene:ENSSTOG00000023884 transcript:ENSSTOT00000026598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSRYFAFCLLLLPIFMSQTVYGQRKKGTKSNLLARKNDLQDSVCFIDVLFIVDSSESSK
LVLFDKQKNFVDSLSDKIFQLTPGHSLKYDIKLAALQFSSSVQIDPPFSSWKDLQTFKQR
VKSMNFIGQGTFSYYAISNATRLLKREGRKDGVKVVLLMTDGMDHPKNPDVQSISESARN
AGISFITIGLLTVNKTKLHLISGDAPSEPILLLSDPTIVDKIRDRLDILFEKKCERKICE
CEKGDPGEPGPPGKHGNPGIKGERGPKGNPGDAQKGETGERGPGGIPGYKGDKGEPGECG
KPGIKGDKGSPGPSGPKGPKGLQGIGGPPGDPGPKGFQGNKGEPGPPGPYGPPGAPGIGQ
QGIKGERGQEGRTGAPGPIGVGQPGQPGPRGPEGAPGERGLPGEGFPGPKGEKGSEGPIG
PQGLQGLSIKGDKGDLGPVGPQGPMGIPGTGSQGEQGIQGPIGPPGPQGPPGQGLPGSKG
EVGPIGPTGPRGPVGIGAQGPKGEPGSKGSPGQTGEPGEDGAAGKKGEAGLPGTRGPEGP
PGKGQPGPKGDEGKKGSKGNQGHMGFPGPAGPKGEQGIMGPFGMPGPSIPGPPGPKGDRG
GPGMPGFKGEPGLFIRGPKGAQGPQGPKGAPGLKGDGYPGVSGPRGLPGPPGPMGLRGVG
DTGAKGEPGVRGPPGPAGPRGIGTQGPKGDIGQKGLPGPPGPPGYGSQGIKGEQGPQGFP
GPKGTRGQGLPGQKGEHGEQGDVGKKGEKGELGDPGSPGKQGLQGPKGDAGLTVSICSSL
NICLLGCGRKCKETPLELVFVIDSSESVGLNNFQIIQNFVKSLADRISVDLATARIGIIN
YSHKVEIVADLRQFSSKDDFKLAVDNMQYLGEGTYTATALQAANDMFKSARPGIKKVALV
ITDGQTDSRDKKNLTEVVKEAKDTGVEIFVIGVVKKSDPNFDMFLKEMNLIATDPQHVYH
FDDFLTLLDTLKQKLSTKICEDFPSYLAKVFGSSSSQPEFGVLGEELGVSTPEPPEEISE
SFSVPGPKHEENEPPEPTWAHRLVVTSSSEAAATLGPLLSTLESIPDPRCLEDLKPGNCV
DYVVRWYYDKQVNSCARFWYSGCSGSGNRFNSEKECQEICIQG
Download sequence
Identical sequences ENSSTOP00000018306 ENSSTOP00000018306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]