SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018555 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018555
Domain Number 1 Region: 3-213,277-337
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.35e-33
Family D-aminoacid oxidase, N-terminal domain 0.000000134
Further Details:      
 
Domain Number 2 Region: 200-292
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.4e-24
Family D-aminoacid oxidase-like 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018555   Gene: ENSSTOG00000011598   Transcript: ENSSTOT00000021982
Sequence length 352
Comment pep:known_by_projection scaffold:spetri2:JH393579.1:744872:758090:1 gene:ENSSTOG00000011598 transcript:ENSSTOT00000021982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTMRVVVIGAGVIGLSTALCIHQRYHSDLQPLDMKVYADRFTPHTTTDVAAGLIQPYISP
PEDPREMDWNQQTFDYLLSQVHSPTADKMGLALISGYNLFREAVPRQNDPVWKDIVLGFR
KLTPRELDMFPDYGYGWFNTSLILDGRTYLKWLTERLTERGVQFFLRKVASLEEVARGGV
DVIINCTGVWAGALQPDPLLQPGRGQVIQVEAPWMKHFIITHDPERGIYKTPYIIPGSQT
VTLGGTFQLGNWTELIDTQDHDTIWEGCCRLEPTLKNARLVGVRAGFRPARPRIRLERDR
LPGGPADTEVIHNYGHGGQGITIHWGCALEAAKLFGKILEERRHPPTSEDHL
Download sequence
Identical sequences ENSSTOP00000018555 ENSSTOP00000010409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]