SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018590 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018590
Domain Number 1 Region: 59-367,474-510
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.24e-63
Family FAD-linked reductases, N-terminal domain 0.00000626
Further Details:      
 
Domain Number 2 Region: 348-454
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.34e-27
Family L-aminoacid/polyamine oxidase 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018590   Gene: ENSSTOG00000019779   Transcript: ENSSTOT00000025348
Sequence length 573
Comment pep:known_by_projection scaffold:spetri2:JH393474.1:3675152:3681752:-1 gene:ENSSTOG00000019779 transcript:ENSSTOT00000025348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLALRLLTLVPILLSLAASLDWKVAFSQDPFEKCMQDPDYEQLLKVVTLGLNRTLKPQ
KVIVVGAGVAGLVAAKVLGNAGHKVTILEADNRIGGRILTFRDRKTGWIGELGAMRMPNS
HRILQELCKSLGLNLTKFTQYDENTWTEVNDMKLRNYVVEKMPEKLGYNLSSKEKSHSPE
EIYQMALHKALKEVMVLGCRKAMKRFDRLTLLEYLVWESNLSQSAVRLLGDVMSKDGFFH
LSFTEALRAHSCLSDRLGYSRIVGGWDLLPRALLSSLSGPVLLNAPVIAITQSMQEVRVH
IATSHTSRNPKALTADVVLLTASGPALQRITFSPPLSRKRQEALRQLHYVPATKVFLNFR
RAFWRDERIEGGHSNTDRPSRQIFYPAPDEGALLLASYTWADSAAVFSGLSPNDAMRLAL
NDLATLHGPLVYRLWDGSGVVKRWEDDPHSQGGFVVQPPFLWQTDQDDGQDFDWVVPYGR
IYFAGEHTAHPHGWVETAVKSALRVAIKINTREWPGRVDKGKEGHVEMHVERQGDVQEEA
SYPPCREGKGEPTHGAAPQLPSVQHTDHLSGLN
Download sequence
Identical sequences ENSSTOP00000018590 ENSSTOP00000018590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]