SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018979 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018979
Domain Number 1 Region: 42-112
Classification Level Classification E-value
Superfamily Ribosomal protein S19 7.85e-21
Family Ribosomal protein S19 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018979   Gene: ENSSTOG00000020431   Transcript: ENSSTOT00000025894
Sequence length 116
Comment pep:novel scaffold:spetri2:JH393324.1:11422151:11422522:-1 gene:ENSSTOG00000020431 transcript:ENSSTOT00000025894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVEQKKKQTSKFTYRSGDLDQLLDMSLYRAGQQRLNRSLRRKQHSVLKRLRKAKKEAP
PTEKPKVVKTHLRDMITLPEMVGSMVGVYNGKTFSQVEIKPKTGHYLGELSIPTSP
Download sequence
Identical sequences ENSSTOP00000023054 ENSSTOP00000018979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]