SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018996 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018996
Domain Number 1 Region: 215-321
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.27e-27
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.002
Further Details:      
 
Domain Number 2 Region: 153-212
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000436
Family TGS domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018996   Gene: ENSSTOG00000020865   Transcript: ENSSTOT00000020691
Sequence length 322
Comment pep:novel scaffold:spetri2:JH393293.1:2155195:2202861:1 gene:ENSSTOG00000020865 transcript:ENSSTOT00000020691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEALAAEAVASRLERQEEDIRWLWTEVQRLRDEQLNAPDRCQAEGPCLTREVAQLRAE
NRDLRHRLYRLRLCLAEELSHQAERAAAGAQPPSSQSQEKDIQKEKLKEHGPDSEVKQPN
FIKERLELFETLKKEHQLLHAMCETKENASNVIAVRLADGKKVEGEIWKTTPYHVAAEIS
QELAENTVVAKVNGELWDLDRPLEGDSSLELLMFDNEEAQAVYWHSSAHILGEAMEIYYG
GHLCYGPPIENGFYYDMFIGDRAVSSTELSALEDICKTIIKEKQPFERLEVSKETLLDMF
KYNKFKCRILKEKVDTPTTTVY
Download sequence
Identical sequences ENSSTOP00000018996 ENSSTOP00000018996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]