SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019043 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019043
Domain Number 1 Region: 19-160
Classification Level Classification E-value
Superfamily Ankyrin repeat 7e-37
Family Ankyrin repeat 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019043   Gene: ENSSTOG00000021946   Transcript: ENSSTOT00000019389
Sequence length 183
Comment pep:known_by_projection scaffold:spetri2:JH393554.1:784622:792517:-1 gene:ENSSTOG00000021946 transcript:ENSSTOT00000019389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPRPFADSHCCSRPVAVPGVQQTLEEMDFERGIWSAALNGDLNRVKHFIQKSTDPSQP
DSAGYTALHYASRNGHYAVCQFLLENGAKCDAQTHGGATALHRASYCGHTEVARLLLAHG
SNPQLVDDDGMTSLHKAAEKGHVDICCLLLQHSPALKAVRDRKARLACDLLPCNSDLRGL
LAS
Download sequence
Identical sequences I3N3U7
ENSSTOP00000019043 XP_005339651.1.77405 ENSSTOP00000019043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]