SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019097 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019097
Domain Number 1 Region: 57-365,451-514
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.42e-62
Family FAD-linked reductases, N-terminal domain 0.00000285
Further Details:      
 
Domain Number 2 Region: 350-462
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.92e-32
Family L-aminoacid/polyamine oxidase 0.0000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019097   Gene: ENSSTOG00000021319   Transcript: ENSSTOT00000027770
Sequence length 526
Comment pep:novel scaffold:spetri2:JH393407.1:148708:156223:1 gene:ENSSTOG00000021319 transcript:ENSSTOT00000027770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFFSTWGEKRSFLALALLSMLGVSTQAFDDDLVKCFEDPQYEELLQLAQDGLGPTAEKKR
IVVIGAGMAGLTAAKILQDAGHQVTVLEASGRVGGRIETHRVPGTQLYIELGAMRIPINH
RLCHEFIRKLGLTLKEFFPSNNQTWVLINGVRQRTGIVQADPSLLGYPVRADEVGKTAEQ
LFDEALRKAKLVEELKNSSCSQILEKYDSFSTKEYLIKVGNLSRGAVQMIGDLLNTDSGY
YESFIETLRDQIIFSQESRFHEIVGGFDQLPQALHGALLPGTVLFHSPAEEVEISRDHVN
VTFRTTDPLQPRSRLTADFVVVANTAKAARLLRFRPPLSLNKENSLHSVHYTSATKVILA
CTQHFWEQEGIFSGKSCTDRPARFIYYPSHTFPNGTGVILASYTVSDDSMFFAAMDDAQV
VDVILDDLAAVHDHPKEQLRALCPYSMVKHWSQDPYSMGAYTSFTPYQYVDYTQELSHPE
GRVHFAGEHTALPHGWTDTAIKSGFRAAKSIQESLDLALTKDPEDT
Download sequence
Identical sequences ENSSTOP00000019097 ENSSTOP00000019097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]