SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019348 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019348
Domain Number 1 Region: 49-123
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 9.55e-30
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019348   Gene: ENSSTOG00000023521   Transcript: ENSSTOT00000023696
Sequence length 125
Comment pep:known_by_projection scaffold:spetri2:JH393309.1:7040710:7043720:1 gene:ENSSTOG00000023521 transcript:ENSSTOT00000023696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDLVKNHLMYAV
REEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSRLSPEEPAAQSPQAPEAP
GGSAV
Download sequence
Identical sequences ENSSTOP00000019348 ENSSTOP00000019348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]