SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019476 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019476
Domain Number 1 Region: 24-197
Classification Level Classification E-value
Superfamily TIMP-like 2.55e-68
Family Tissue inhibitor of metalloproteinases, TIMP 0.00000424
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019476   Gene: ENSSTOG00000023341   Transcript: ENSSTOT00000021303
Sequence length 211
Comment pep:known_by_projection scaffold:spetri2:JH393302.1:6999230:7046169:-1 gene:ENSSTOG00000023341 transcript:ENSSTOT00000021303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPWLGLVVLLGSWSLGEWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTL
VYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNF
VERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSK
HYACIRQKGGYCSWYRGWAPPDKSIINATDP
Download sequence
Identical sequences I3N530
ENSSTOP00000019476 XP_005322373.1.77405 XP_015338281.1.40921 ENSSTOP00000019476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]