SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019631 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019631
Domain Number 1 Region: 65-217
Classification Level Classification E-value
Superfamily EF-hand 2.4e-27
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019631   Gene: ENSSTOG00000020670   Transcript: ENSSTOT00000023088
Sequence length 224
Comment pep:novel scaffold:spetri2:JH393301.1:6813035:6815444:1 gene:ENSSTOG00000020670 transcript:ENSSTOT00000023088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVSLKYIYNIWNVNELYKNYRPQYRDKINWNKSIYNYYYYYYGNPTEFQDSSDHHTFKKM
LPRDERRFKAADLDGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDE
YIANMFSHEDNGPEPDWVLSEREQFSDFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARH
LVYESDKNKDEKLTKEEILDNWNMFVGSQATNYGEDLTKNHDEL
Download sequence
Identical sequences ENSSTOP00000019631 ENSSTOP00000019631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]