SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019794 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019794
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily Globin-like 4.36e-45
Family Globins 0.00000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019794   Gene: ENSSTOG00000020012   Transcript: ENSSTOT00000024758
Sequence length 142
Comment pep:known_by_projection scaffold:spetri2:JH393311.1:725568:726198:-1 gene:ENSSTOG00000020012 transcript:ENSSTOT00000024758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSARDRAMVRALWKKLGDNVGVYTTEALERTFLSFPGTKTYFPHLDLSPGSAQVKAHG
QKVAAALTLAVDQLDDLPGALASLSDLHAHKLRVDPANFQLLCHCLLVTLARHYPGDFSP
TMQASLDKFLSHVTSTLVSKYR
Download sequence
Identical sequences I3N5Z8
ENSSTOP00000019794 ENSSTOP00000019794 XP_005323727.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]