SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019897 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019897
Domain Number 1 Region: 1-226
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.04e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0032
Further Details:      
 
Domain Number 2 Region: 313-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000583
Family FAD/NAD-linked reductases, N-terminal and central domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019897   Gene: ENSSTOG00000027435   Transcript: ENSSTOT00000025196
Sequence length 533
Comment pep:novel scaffold:spetri2:JH393834.1:120694:150705:-1 gene:ENSSTOG00000027435 transcript:ENSSTOT00000025196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKQRISVIGAGASGLSSIKCCLDEDLEPVCFERTDDIGGLWRYQENPEEGRASIYKSVI
INTSKEMMCFSDYPVPDHYPNFMHNSQILEYFRMYAKDFDLLKYIQFKTTVCSVKKRPDF
STSGQWEVVTECDGKKEVDVFDGVMVCTGHHTNAHLPLESFPGIEKFKGQYFHSRDYKNP
EAFAGKRVIIIGIGNSGGDLAVEISHTAKQVFLSTRRGAWILNRVADRGYPFDVAHLSRL
QHRLSKICGQALTNAYLEKRLNQRFDHEMFGLKPKHRALSQHPTVNDDLPNRILSGLVKV
KGNVEAFSETAAVFEDGSREDDIDAVIFATGYSFAFPFLEDSIKVVKNKISLYKKVFPPN
LEKPTLAIIGLIQPLGAIMPIAELQGRWATQVFKGLKKLPSQSEMMADISKTQEEMAKRY
VESQRHTIQGDYIDSMEEIAGLLGVRPSPLSLAFTDPKLALQLLLGPCTPAQFRLRGPGK
WAGARKTILSTDDRIRKPMKTRVMDKSDSAASAVALGRFMLALILFAVIVAYF
Download sequence
Identical sequences I3N6A1
XP_013221648.1.77405 XP_021577057.1.77405 XP_021577058.1.77405 ENSSTOP00000019897 ENSSTOP00000019897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]