SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019926 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019926
Domain Number 1 Region: 19-147
Classification Level Classification E-value
Superfamily Lysozyme-like 2.17e-55
Family C-type lysozyme 0.000000584
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019926   Gene: ENSSTOG00000023060   Transcript: ENSSTOT00000020890
Sequence length 148
Comment pep:novel scaffold:spetri2:JH393355.1:7165927:7170098:1 gene:ENSSTOG00000023060 transcript:ENSSTOT00000020890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAFLILGLLLLSVTVQGKVYGRCELARALKRLGMDGYRGISLANWVCLAKWESSYNTRA
TNYNPGSRSTDYGIFQINSRYWCNDGKTPRAVNACGISCSALLQDDISQAVTCAKRVVRD
PQGIRAWVAWRNRCQNRNLSQYIQGCGV
Download sequence
Identical sequences I3N6D0
XP_005328788.1.77405 ENSSTOP00000019926 ENSSTOP00000019926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]