SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020106 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020106
Domain Number 1 Region: 17-327,422-457
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.4e-64
Family FAD-linked reductases, N-terminal domain 0.000000457
Further Details:      
 
Domain Number 2 Region: 308-403
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.32e-27
Family L-aminoacid/polyamine oxidase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020106   Gene: ENSSTOG00000021901   Transcript: ENSSTOT00000029323
Sequence length 459
Comment pep:novel scaffold:spetri2:JH393284.1:24387977:24392168:1 gene:ENSSTOG00000021901 transcript:ENSSTOT00000029323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESFLVTAQEGLHTSPLPKHIVVVGAGMSGLTAAKTLQDAGHQVTILEASDHAGGRVVTFR
NKEEGWYFDLGPMRIPKSHRLIHTYIKKLGLKLNKFIQYDGNTWYLINGQRTTSQLGGQG
QPRDPGYSTNPTEKGKSAMNLFHQSIVKLKQSLKMFNCSHLMSFYDSYSTKAYLVKKGML
SGGAVQMIGDVMNENAAYYKSLLESLRNANIFSKSDDFYEITGGFDQLPRALSTSLKPGT
IHLGSKVEMVVRDGPEVRVLYRKGGPTSELRNLTADYIIISASAKATRLIASQPPLSPDK
TNALSSMHYTSATKVVLACDEHFWERDGIRGGVSTTDPPSRYIHYPSHNFPSGKGVLLAS
YTVDDDSLFFTAMKHEQVVDIVLDDLAAVHQIPKEELRHHPLTIGAFAEFTPYQFVDYAQ
KLFQPEGRVHFAREHTSLPHGWMDTAVKSGLRAARNIQA
Download sequence
Identical sequences ENSSTOP00000020106 ENSSTOP00000020106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]