SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020574 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020574
Domain Number 1 Region: 43-238
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 3.14e-77
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0000107
Further Details:      
 
Domain Number 2 Region: 318-474
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 1.31e-66
Family C-terminal domain of adenylylcyclase associated protein 0.0000000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020574   Gene: ENSSTOG00000022338   Transcript: ENSSTOT00000020280
Sequence length 474
Comment pep:known_by_projection scaffold:spetri2:JH393284.1:21855101:21882306:1 gene:ENSSTOG00000022338 transcript:ENSSTOT00000020280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADMQNLVERLERAVGRLEAVSHTTDMHLGYGDSPSKAGAVPYVQAFDSLLASPVAEYLK
ISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAGNKLSDLLAPISEQIQEVITFRE
KNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHV
DWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSVGSGPPPPPPGPPPP
PVPTSSGSDDSASRSALFAQINQGERITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPF
SAPKPQTIPSSKPATKEPPLLELEGKKWRVENQENVSNLVIDDTELKQVAYIYKCVNTTL
QIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHAYLS
KNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG
Download sequence
Identical sequences ENSSTOP00000020574 ENSSTOP00000020574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]