SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020601 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020601
Domain Number 1 Region: 37-109
Classification Level Classification E-value
Superfamily Neurophysin II 1.83e-31
Family Neurophysin II 0.00000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020601   Gene: ENSSTOG00000023996   Transcript: ENSSTOT00000025022
Sequence length 109
Comment pep:known_by_projection scaffold:spetri2:JH393295.1:15608036:15608650:-1 gene:ENSSTOG00000023996 transcript:ENSSTOT00000025022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APTMASLSLPCCLLGLLALTSACYIQNCPLGGKRTTLELDMRKCLPCGPGGKGRCFGPSI
CCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGFCCS
Download sequence
Identical sequences ENSSTOP00000020601 ENSSTOP00000020601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]